PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04103A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 177aa    MW: 20186.1 Da    PI: 8.7077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04103AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-161461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd++lv     +G  +W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_04103A 14 KGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                               79******************************99************97 PP

2Myb_DNA-binding56.65.8e-1870111447
                                S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                 ++eE+ l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Oropetium_20150105_04103A  70 LSEEEEALVIDLHAQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                                699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-21563IPR009057Homeodomain-like
PROSITE profilePS5129415.529961IPR017930Myb domain
SuperFamilySSF466894.12E-2811108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002499.1E-151461IPR001005SANT/Myb domain
CDDcd001677.57E-101661No hitNo description
PROSITE profilePS5129428.28462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-2664116IPR009057Homeodomain-like
SMARTSM007175.0E-1666114IPR001005SANT/Myb domain
PfamPF002497.9E-1670111IPR001005SANT/Myb domain
CDDcd001671.67E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAE EDQKLVAFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEEEEALVID LHAQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHRPLC PSSQSSAEPE PLASQQQRQD PPQVRGEGRD DLKEDDDEDA EALVRSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9646201e-139EU964620.1 Zea mays clone 280394 odorant 1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149774.13e-95odorant 1 protein
SwissprotQ50EX62e-83ODO1_PETHY; Protein ODORANT1
TrEMBLB6TI053e-95B6TI05_MAIZE; Odorant 1 protein
STRINGGRMZM2G055158_P012e-94(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-85myb domain protein 20